22 July 2021
AperTO - Archivio Istituzionale Open Access dell'Università di Torino
Original Citation:
Leptin identification and quantification in human and bovine milk and infant formulas
Terms of use: Open Access
(Article begins on next page)
Anyone can freely access the full text of works made available as "Open Access". Works made available under a Creative Commons license can be used according to the terms and conditions of said license. Use of all other works requires consent of the right holder (author or publisher) if not exempted from copyright protection by the applicable law. Availability:
This is the author's manuscript
Leptin identification and quantification in human milk and infant formulas
Claudio Medana, Federica Dal Bello, Valentina Santoro, Michael Zorzi, Daniela Gastaldi, Riccardo Aigotti
Department of Molecular Biotechnology and Health Sciences, University of Turin, via P. Giuria 5 , 10125 Torino – Italy
E-mail: [email protected]
OVERWIEW
References: 1) J.M. Friedman, J.L. Halaas. Leptin and the regulation of body weight in mammals. Nature, 395, 763 (1998)
2) F. Savino, A. Sardo, L. Rossi, S. Benetti, A. Savino and L. Silvestro. Mother and Infant Body Mass Index, Breast Milk Leptin and Their Serum Leptin Values. Nutrients, 8, 383 (2016)
3) Y. Wang, J.S. Heilig. Differentiation and quantification of endogenous and recombinant-methionyl human leptin in clinical plasma samples by immunocapture/mass spectrometry. J. Pharm. Biomed. Anal. 70, 440 (2012)
Figure 1: MS/MS: m/z 1244, z=13 Figure 4: natural human leptin primary sequence with digestion peptides used for quantification in evidence F8: Phenazone ESI main fragmentation pathways F9: Phenazone D1, D2, D3 ammonia/methyl lossesINTRODUCTION
Leptin is a small protein (16 KDa) present in plasma and milk. It plays a key role in the regulation of body weight and its concentration is affected by many physio-pathological parameters especially body weight variation
and lipodystrophic conditions1. Leptin is encoded by the obesity gene on
human chromosome 7 and it is mainly secreted by adipocytes. It is possible that serum leptin concentration in breastfed infants is associated to early adipose tissue production and to the leptin levels in
milk2. In order to understand the role of different newborn feeding
(breastmilk, formulas, bovine milk) on infant leptin production and risk of obesity, we aimed to develop a selective nLC-HRMS method to evaluate leptin content in different milk matrices.
Quantitation of leptin after hydrolysis
The sample eluted from immunoaffinity columns was digested in order to detect marker peptides.
Sample preparation: digestion with Trypsin. Make up 200 mM dithiotreitol (DTT) in 50 mM ammonium
bicarbonate for reduction step. Add 2.1 µL of DTT, heat solution at 60°C for 15 minutes. Remove from heat and cool for 5 minutes. Make up a 200 mM iodoacetamide (IAM) in 50mM ammonium bicarbonate for alkylation step. Add 4.4 µl of IAM and incubate the solution in the dark at room temperatures for 30 minutes. Add 2.5 µl of Trypsin solution (1 µg µL-1). Digest overnight at 37°C.
LC: Thermo Ultimate 3000 nano, column: Accucore C4 2,6 µm, 150 Å, 75 µm x 15 cm column, HCOOH
0.1% in water - HCOOH 0.1% in ACN/H2O gradient 95:5-1:99 in 98’, 0.3 µL min-1, injection volume : 1 µL
ESI MS: Thermo Orbitrap Fusion with Easy-nanoLC source, FM and data dependent analysis acquisition.
Human milk and infant formulas were provided from local pediatric hospital. In order to detect leptin concentrations < 0.1 fM, immunoaffinity extraction was performed (Experim., meth 1).
Intact leptin was not identified neither in breast milk nor in infant formulas, so the purified samples were subjected to trypsin digestion (Experim., meth 2).
Leptin quantitation in breast milk samples by MS/MS quantitation of m/z 708 ion: Sample A: 7.1 µg mL-1;
Sample B: 6.3 µg mL-1
Leptin quantitation in infant formula samples by MS/MS quantitation of m/z 708 ion: Sample C < LLOQ; Sample D: < LLOQ.
Perspectives: to perform intact protein quantitation by enhancing method 1 sensitivity and by
optimizing analyte protein immunoaffinity extraction.
Evaluation of leptin in breast milk and commercial infant formulas
•
The LC-HR MS and HR MS/MS behavior of leptin was evaluated bythe use of a Orbitrap Fusion tribrid analyzer. Bottom-up and top-down approaches were compared.
• We aimed to quantify leptin in human milk and infant formulas, so
an immunoaffinity extraction was performed in comparison with direct detection.
• The protein analyte was detected in human milk at 6-7 µg L-1.
Top-down characterization and quantitation of intact leptin
DISCUSSION
CONCLUSIONS
At first human leptin as intact protein was extensively characterized by high resolution mass spectrometry in order to evaluate interferences. Full MS and CID/ETD MS/MS spectra (Figure 1) of multicharged positive ions of standard proteins were acquired. A top-down approach was used with the aim of reduce to a minimum sample manipulation. Accuracy, precision, LLOQ and linearity were then assessed. After immunoaffinity extraction in the samples analyzed (both human milk and infant formulas samples) an intense protein signal different from leptin was detected. After digestion of the immunoaffinity purified samples both qualifier (m/z 764) and quantifier (m/z 708) peptides from leptin were identified. These peptides were specifically calibrated using digested standard leptin (Figure 4).
AP
PL
IC
AT
IO
N
TO
M
IL
K
SAM
PL
ES
TO
P-DO
W
N
L
C-MS
BO
TT
O
M
-UP
L
C-MS
LLOQ 175 ng mL-1 (175 pg on-column); linearity 175-1000 ng mL-1
Experimental
:
Leptin evaluation in real samples:Figure 6: chromatogram of a digested breast milk sample
CID
ETD
INDISHTQSVSS
m/z 708, z = 2
NVIQISNDLENLR
m/z 764, z = 2
m/z 708, z = 2 y = 24248x - 4E+06 R² = 0,99711 0,00E+00 2,00E+07 4,00E+07 6,00E+07 8,00E+07 1,00E+08 1,20E+08 1,40E+08 0 1000 2000 3000 4000 5000 6000 Ar ea Concentration (µg/mL)After digestion of purified samples leptin was quantified in samples (besides identification of interfering unknown proteins: lactoferrin and β-lactoglobulin). The method was applied to investigate about the presence of leptin in two different commercial infant formulas. In this kind of food supplements leptin resulted < LLOQ (1 µg/L).
Finally leptin concentration was quantified in human breast milk samples, obtaining values of 6-7 µg/L.
The developed method displays a better sensitivity compared to
literature3 and can be used for milk and plasma leptin dosage.
Data acquisition of new samples for statistical purposes is being implemented.
MHWGTLCGFLWLWPYLFYVQAVPIQK
VQDDTKTLIKTIVTR
INDISHTQSVSS
K
QKVTGLDFIPGLHPILTLSKMDQTLAV
YQQILTSMPSR
NVIQISNDLENLR
DL
LHVLAFSKSCHLPWASGLETLDSLGGVL
EASGYSTEVVALSRLQGSLQDMLWQLD
LSPGC
The human milk was prepared and purified following a immunoaffinity protocol in order to detect leptin as intact protein.
Sample preparation: purification of human milk with glycoLink micro immobilization kit and monoclonal
antilep antibody (Sigma Aldrich). Make up 2,5 µL of antilep antibody in 97,5 µL of glikolink coupling buffer and add 11 µL of NaIO4 0.1 M for desalting step. Bind the antilep antibody to the column resin and equilibrate this latter with a pH 7-8 PBS buffer. Incubate overnight at 4°C 250 µL of human milk with binded antilep antibody. Elute analyte (leptin protein) with glicine HCl solution pH 2.5-3 0.2 M and neutralize the eluating with tris buffer 1M pH 8.5-9.
LC: Thermo Ultimate 3000 nano, column: Pepmap C18 2 µm, 100 Å, 75 µm x 25 cm column, HCOOH 0.1% in
water - HCOOH 0.1% in ACN/H2O 80/20 gradient 95:5-10:90 in 25’, 0.3 µL min-1, injection volume : 1 µL.
MS: Thermo Orbitrap Fusion with Easy-nanoLC source, FM and MS2 acquisition.
RT:9.66 - 114.01 SM:11G 10 20 30 40 50 60 70 80 90 100 110 Time (min) 10 15 20 25 30 35 40 45 50 55 60 65 70 75 80 85 90 95 100 R e la tive A b u n d a n ce 46.56 79.69 71.01 43.94 53.99 27.28 31.01 62.20 47.14 39.00 58.36 14.85 24.91 37.76 50.59 78.63 67.81 85.5889.56 101.28 106.11 NL: 1.45E9 TIC F: FTMS + p NSI Full ms [200.0000-2000.0000] MS C3_LatteMaterno_Orl andini_DIG RT:9.92 - 114.63 SM:11G 10 20 30 40 50 60 70 80 90 100 110 Time (min) 0 10 20 30 40 50 60 70 80 90 100 R e la tive A b u n d a n ce 28.81 33.77 46.61 79.68 45.02 26.74 22.36 71.07 20.42 19.29 37.51 62.39 47.26 43.35 50.69 54.21 104.96 99.12 57.80 64.48 89.70 106.12 78.40 88.17 96.62 NL: 1.09E9 TIC F: FTMS + p NSI Full ms [200.0000-2000.0000] MS C2_Mellin0nascita _DIG
Leptin_1ppm_001 #2402RT:15.84AV:1NL:4.24E6
F:FTMS + p NSI Full ms [700.0000-2000.0000] 700 800 900 1000 1100 1200 1300 1400 1500 1600 1700 1800 1900 2000 m/z 0 5 10 15 20 25 30 35 40 45 50 55 60 65 70 75 80 85 90 95 100 R e la tive A b u n d a n ce 1154.8934 z=14 1243.7307 z=13 1077.9672 z=15 1347.2076 z=12 1010.7189 z=16 1469.7706 z=11 1795.9415 z=9 1616.6454 z=10 758.2188 z=1 951.2061 z=? 832.2368 z=1 1199.7556z=? 1723.0992z=? 1267.4291 z=? 1954.1998 z=? 1665.1259 z=? 1815.9998 z=? 1537.3066 z=? 1491.2700 z=? 1436.4917 z=? 1587.3596 z=? 1369.9572 z=? RT:0.00 - 35.01SM:7G 0 2 4 6 8 10 12 14 16 18 20 22 24 26 28 30 32 34 Time (min) 0 5 10 15 20 25 30 35 40 45 50 55 60 65 70 75 80 85 90 95 100 R el at ive A bu nd an ce 15.84 16.56 14.26 6.12 7.41 5.85 13.84 3.68 9.17 11.22 17.5018.5020.95 23.74 27.7329.26 29.6930.11 31.61 1.79 NL: 4.78E7 m/z= 1010.20-1011.20+1077.50-1078.50+ 1154.40-1155.40+1243.20-1244.20+ 1346.70-1347.70+1469.30-1470.30+ 1615.90-1616.90+1795.40-1796.40 F: FTMS + p NSI Full ms [700.0000-2000.0000] MS Leptin_1ppm_001 LLOQ 100 ng mL-1 (100 pg on-column); linearity 175-5000 ng mL-1
Figure 2: intact leptin chromatogram and full-Ms spectrum at 1000 ng mL-1 y = 617041x - 1E+08 R² = 0,98509 0,00E+00 1,00E+08 2,00E+08 3,00E+08 4,00E+08 5,00E+08 6,00E+08 0 200 400 600 800 1000 1200 TIC Figure 3: MS/MS fragmentation of standard recombinant methionyl human leptin, MVPIQKVQDDTKTLIKTIVTRINDISHTQSV SSKQKVTGLDFIPGLHPILTLSKMDQTLAVY QQILTSMPSRNVIQISNDLENLRDLLHVLAF SKSCHLPWASGLETLDSLGGVLEASGYSTE VVALSRLQGSLQDMLWQLDLSPGC
Figure 5: chromatograms and MS/MS spectra of m/z 708 and 764 ions
Figure 7: chromatogram of a digested infant
formula sample Figure 8: extracted chromatograms of m/z 708 and 764 ions: Breast milk vs. two different infant formula samples